PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009962
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TALE
Protein Properties Length: 603aa    MW: 68077.9 Da    PI: 5.3255
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009962genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-094294661954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   n+yp+ +e+  LA+k gLt +qV +WF N R +
  DCAR_009962 429 FEHflNPYPKDSEKSMLARKAGLTRSQVANWFINARVR 466
                  665559******************************88 PP

2BELL104.11e-33295365272
         BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  r + ++k +kLlsll+eVd rYkqy++q+++v  sFe +ag+g+ak YtslAl++iS +FrcL+dai  qi
  DCAR_009962 295 RLDQESKLTKLLSLLKEVDTRYKQYYHQMRIVETSFEKIAGCGAAKRYTSLALQTISCQFRCLRDAINRQI 365
                  67889***************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.0E-42213363IPR006563POX domain
PfamPF075262.2E-38220361IPR006563POX domain
PROSITE profilePS5007112.519407470IPR001356Homeobox domain
SMARTSM003894.4E-7410474IPR001356Homeobox domain
CDDcd000866.54E-11410471No hitNo description
SuperFamilySSF466893.25E-16411476IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-26413476IPR009057Homeodomain-like
PfamPF059202.2E-16427466IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MDTYYPNSSN QESHVLRAPY VPIQKLDSYN ELSRLPDNMF YLNQTSADDS YPELKSGSSL  60
SPKSCDGVPY VGGTDRGVFV PFMSDCVSPL LPQQVNMAER VQNNRLSKQH ILSRTSRECE  120
DLHEQRLSLS LGAELTSSRQ LPSIQYQFGN SDPLQLINFL TKDSGKVGSQ NEESNTGEFL  180
SFGLNGNAED VTNFRDFNNS DSSRQMQYAY SFEGSQYSFE NSNYLKGAQQ LLDEVVNVYD  240
ALKKPKFKCI GQVDKCEGSN SYIKSDPGLR LDSGKFSGLE ESAMNSSVAL PNAERLDQES  300
KLTKLLSLLK EVDTRYKQYY HQMRIVETSF EKIAGCGAAK RYTSLALQTI SCQFRCLRDA  360
INRQIQVCRQ SLGEQDDEPN SSLLPRLSYV DKHIRQQRTL QQLGVMRHSW RPQKGLPESS  420
VSVLRAWLFE HFLNPYPKDS EKSMLARKAG LTRSQVANWF INARVRLWKP MVEDMYKEEF  480
GDLESDKKEE VKESVMSGAT YDDHLRQFSG PGADPRYDLN MKESTRPDYK NLSQGDGAID  540
GEVISLHGDN WSGVDEHYIC PQKFITSNQT DGSLNAIASP YDLSSFGDFT INSQVSNFVL  600
QC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-15416473158Homeobox protein Meis1
4xrs_B3e-15416473158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9SIW12e-97BLH7_ARATH; BEL1-like homeodomain protein 7
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-91BEL1-like homeodomain 7